Meta business manager Grow online sales. Use our quick-start guide to begin using Meta Business Manager. . Tap your profile picture in the bottom right to go to your business’s profile. Commerce Manager is the central tool for all of your online selling activity across Facebook and Instagram. You can use this free platform to: Run and track your ads. Facebook Business Manager, now called Meta Business Manager, is a free platform that helps you manage and organize your business on Facebook. With one click, admins can add new people to ad accounts and Pages, greatly reducing the time it takes to set up and manage marketing efforts. Select the business portfolio that your catalog will belong to. You can create a new Page and add it to your business portfolio in Meta Business Suite or Business Manager. K Business Manageru se můžete kdykoli vrátit . The card reappears if Meta needs to notify you of any new security risks. To edit your information in Business Manager: Go to Business portfolio info in Meta Business Suite or Business info in Business Manager. While Meta Business Suite is the front-end management to handle posts, insights, and messages in one place for both Facebook and Instagram, Business Manager We're gradually upgrading Business settings in Business Manager. People with full control of the portfolio can export a file with users’ permissions from the People tab in Meta Business Suite's Settings or Business Manager's click the Business Manager tab in Settings. Facebook Ads Manager: Ads Management for Facebook, Instagram. Meta Business Help Center Troubleshoot Business Manager. Get support, tips & resources on selling on Facebook & Instagram, business tools, troubleshooting ads, account management, content monetization & more. You can use it to access Meta Business Suite, Business Manager, Ads Manager and other business tools. Click Settings. Connect a Meta Pixel or app SDK to your catalog so you can run Meta Advantage+ catalog ads that show people relevant products from your catalog based on their interests: To add an Instagram account to your business portfolio in Business Manager: Go to Business settings. Meta Ads Manager tracks all changes made to your ad campaigns, ad sets and ads. ; Below Accounts, click Pages. Meta Business Help Center: Help, Support & Troubleshooting Meta Ads - Reach Customers Online with Ads on Facebook, Instagram, Messenger & WhatsApp Facebook Ads Manager: Ads Management for Facebook, Instagram Manage the access and permissions people have to your business portfolio and business assets in Meta Business Suite and Business Manager. Click Save. When you view your activity history, you can see who made changes, Provide your email address to receive the latest updates from Meta for Business, including news, events and product updates. Get started Advertise. number (optional): Enter the Note: Starting in September 2024, we are gradually introducing a significant update to the ad creative section at the ad level in Meta Ads Manager. You can add multiple WhatsApp numbers in Business Manager. What is Meta Business Manager? Meta Business Manager is a tool that helps you manage With Meta Business Suite or Meta Business Manager, you’ll be able to: Oversee all of your Pages, accounts and business assets in one place. From here, you can manage your product catalogs, Provide your email address to receive the latest updates from Meta for Business, including news, events and product updates. In Meta Business Suite and Business Manager, you can request access to the business assets of other business portfolios, Suite, which has the same features and better performance. To finish updating your email address, verify the change via the confirmation email sent to you. Support. Learn more. Look for Ad account creation limit. Meta Business Manager (formerly Facebook Business Manager, or Pages Manager) is a mobile app that supports management of up to 50 Facebook pages from a smart phone or tablet, allowing social media managers to see activity, post updates, and respond immediately to customers. Go to Meta Events Manager. Currency: Select the local currency of your business. ; Select the people you want to migrate. Add an agency or The steps below only apply if you’re trying to add an Instagram account to your business portfolio on Meta Business Suite desktop. You’ll only currently see this update when you create a new campaign using manual setup with single, static media. Din Meta Business-konto er et sted, der opbevarer dine Facebook-sider, Instagram-profiler, annoncekonti og andre Meta for Business gives you the latest news, advertising tips, best practices and case studies for using Facebook to meet your business goals. Facebook Ads. If you still want to access Business settings, click the Business Manager tab in Settings. 6 m; Manage settings and permissions. Our business Meta Business Suite in Creator Studio. It helps you manage your properties and placements, understand your performance and optimize your revenue in one place. Messenger Ads. ; Enter the email address of the person you want to add and click Next. A business portfolio allows organizations to bring their Facebook Pages, Instagram accounts, ad accounts, product catalogs and other business assets together, so they can manage them from one place with business tools such as Meta Business Suite and Business Manager. Provide your email address to receive the latest updates from Meta for Business Meta Business Manager (formerly Facebook Business Manager, or Pages Manager) is a mobile app that supports management of up to 50 Facebook pages from a smart phone or tablet, allowing social media managers to see activity, post updates, and respond immediately to In the Billing section of Meta Ads Manager, you can view and download receipts for individual or all ad charges that have occurred in a specific range of dates. What is Meta (Facebook) Business Manager? Meta Business Manager (formerly Facebook Business Manager) is a tool designed to help business owners connect with customers and sell products across its social media properties. Note: These steps apply to Meta Business Suite desktop only. Click Business info. Select the Page. Meta Business Suite. Learn how to request a release of your Page from a business portfolio. Your business will claim ownership of the Page, If you still want to access Business settings, click the Business Manager tab in Settings. go to your Ad account settings in Ads Manager, and in the section Business info, click on the Edit button. In Business Manager, go to Business settings. Increase sales; Get started with advertising; Your guide to audience Note: Deleting your business portfolio will not delete any connected WhatsApp Business accounts. Accessing Tabs in Meta Business Suite Your role in your accounts will determine what you can access, Rights Manager features will only be visible if you’re already approved for Rights Manager. Choose whether to install the pixel code manually to your website or through a partner integration. Promote Your App. Click Next. ビジネスマネージャは、Meta Business SuiteやMeta広告マネージャと連携して動作します。Meta Business Suiteでは、FacebookやInstagramでのすべてのマーケティング活動と広告活動を一元管理できます。Meta広告マネージャは The Meta Business Account, sometimes called a Business Manager account, was renamed. More in this section: MANAGEMENT TOOLS. Catalog The content will be moved to the Meta for Business website. ; Click the Confirm your business portfolio: You can see all the ad accounts and Pages you manage in Meta Business Manager. Meta Business Manager. Your business ID is the unique number that corresponds to your business portfolio. Updated Jan 15 2025 8:52 PM PST. ; Scroll down the menu and click Invoices. 6 m; Set up two-factor authentication. No known issues. Instagram for Business website pages will no longer be available starting December 2024. Learn More. In Business Manager you connect ads-related assets and other business assets for: Permission management. The main tool to manage your catalog is Commerce Manager , but you can perform some basic actions to manage it with your business portfolio in Meta Business Manager. Once you delete your business portfolio in Meta Business Manager, this action can't be reversed. Note: We're gradually upgrading Business settings in Business Manager. Measure and Optimize Ads. Select Business portfolio info from the left menu. You should see businesses that have requested access to your Page here. You may need your business ID to give a partner access to business assets and information, such as monthly invoices or a Meta Pixel. Easily create and manage ads for all your Manage all of your marketing and advertising activities on Facebook and Instagram. ” You may be redirected to Settings in Meta Business Suite, which has the same features and better performance. But you must remove any connected WhatsApp Business accounts from your Meta Business account before you can delete the business portfolio. Pokud jste dřív používali Business Manager, možná jste si všimli, že jsme přešli na Meta Business Suite. Retarget Existing Customers. When you delete a business portfolio, it permanently erases: Discover how Meta Business Manager can help you create ads, manage business assets, and share access with these tips & best practices. Ads Manager. Ξεκινήστε. V účtu Meta Business najdete své Facebook stránky, instagramové profily, účty pro reklamu a další firemní položky. To select a business portfolio, you must have full control of it. Add an agency or Ads Manager. By logging in, you can navigate to all business tools like Ads Manager, Meta Business Suite, Business Manager, Commerce Manager and more to help you connect with your customers and get better business results. Create your ad. 6 m; All Topics. Use the guide below to take . Generate leads. Promote your app. Log In Business Manager API's help manage multiple ad account assets and permissions. Get started. The currency you select must match the currency you plan to pay your invoice in. You should also see information about the person who has requested access and the business they belong to. ; Enter the Facebook Page name or URL. Meta Business Suitessa voit hallinnoida kaikkia Facebookin ja Instagramin markkinoinnin ja mainonnan toimintoja yhdessä paikassa. Generate Leads. The WhatsApp Business Management API allows you to programmatically manage your WhatsApp Business Account assets, such as message templates and phone numberss. Find your business ID. Payment method (optional): Select a method of payment for your ads. Remember that your Business Manager ID isn't the same as your Facebook Page ID. If you’d like to manage your Facebook Page and your Instagram account from Meta Business Suite, Business Manager uses a 2-layer permission model, which helps businesses securely manage and maintain control of their ad accounts, Pages and catalogs. Click Continue. What is Meta (Facebook) Business Manager? Meta Business Manager (formerly Facebook Business Manager) is a tool designed to help business owners connect with customers and sell products across its social In order to track and manage your monetization with Meta Audience Network, you'll need to set up Monetization Manager, a tool in Meta Business Manager. Click Brand safety and suitability. Once you create a business portfolio in Meta Business Manager, you can add people and assign business assets in Business settings. When you delete a business portfolio, you also delete the content you've created, managed, shared and used. To add assets, you can create a new asset in Business Manager, claim an existing asset, or request access to an asset owned by another business. When you go to your business portfolio in Meta Business Manager, your homepage displays information about alerts, requests, ad accounts, Pages and other assets. Find and reach more customers on Facebook, Instagram and Messenger. Log Into Facebook. ; Click the Meta Business Suite. Associate · 600-101 Provide your email address to receive the latest updates from Meta If you are an agency with multiple clients or a business operating across different regions or brands, you’ll find Business Manager tools and features can make managing your Facebook assets easier. facebook. Grow Online Sales. Click Create to get started. In Meta Business Suite, go to Settings. ; Assign the level of access you want to give to the Business Manager toimii yhdessä Meta Business Suiten ja Metan mainosten hallinnan kanssa. In the Migrations tab, you will see your organization’s business portfolios, the migration status and progress for each, and a Start migration button. Video Ads. O. Your Business Manager homepage provides a comprehensive overview of your business. Metan Meta Business Manager helps advertisers integrate marketing efforts across their business and with external partners. Select a block list to manage the people and partners assigned to it. By submitting this form, you agree to receive marketing related electronic communications from Meta, including news, events, updates and promotional emails. Select Business info Locked out of your Facebook Page? Whether you’re a business owner or an agency that needs access to your client’s account, losing access to your Facebook Page is frustrating. Meta Business Help Center Find business support The Meta Business Account, sometimes called a Business Manager account, was renamed. About Business settings. You can edit the information you want to change. For numbers that are integrated with our WhatsApp Business API, the number will be automatically connected to your Business Manager. You can request an increase to this limit by contacting Direct Support and opening a ticket with WABiz: Account & WABA > Request type > Increase WABA limit for a business. Select Account overview, Campaigns, Ad sets or Ads to manage your assets or view your results in customizable columns. Today we’re expanding the availability of Business Manager, a tool that lets large advertisers manage all of their ad accounts, Pages, apps and permissions in one place — Facebook Business Manager, now called Meta Business Manager, is a free platform that helps you manage and organize your business on Facebook. 6 m; Create new ad accounts. Start Now. Below Requests, click on Other requests. Meta further explains that Meta Business Suite simplifies the process of building and managing your presence on Facebook and Instagram. chevron-down. Instagram Ads. To manage block lists in Business Manager: Go toBusiness settings. You can also give someone access to your Page from Meta Business Suite:. A WABA must belong to only one Business Manager. Add an agency or Assets include Facebook Pages, pixels, ad accounts, Instagram accounts and more. SETTINGS Provide your email address to receive the latest updates from Meta for Business, including news, Meta Business Suite. You cannot have two or more Business Managers owning one WABA. ; Below Accounts, click Instagram accounts. ; Select the name and ID of your data. Meta Business Suite is a mobile and desktop app that enables you to link all of your Facebook and Instagram accounts, You can use the features of Meta Business Suite to consolidate the management of your accounts, ads, content Steps to view your invoices in Business Manager: Open Business Manager. If you prefer a mobile device experience you can also download Ads Manager app for Android and iOS. ; Click + Add in the top right. Set Up a Facebook Page. ; Click the Data sources icon in the left menu of the page. Run campaigns on behalf of another company. You can also use Events Manager to compare activity across your business’s sources over time and create audiences. ; Click Assign people. Meta Business Manager (formerly Facebook Business Manager, or Pages Manager) is a mobile app that supports management of up to 50 Facebook pages from a smart phone or tablet, allowing social media managers to see activity, post updates, and respond Business Manager di Meta è uno strumento che ti aiuta a gestire le autorizzazioni del tuo account business di Meta. View All Goals. By submitting this form, you agree to receive marketing Measures competency in media buying, campaign planning and management, and ad performance optimization on Meta technologies. To contact Meta Verified Support on Instagram: Open the Instagram mobile app and log into your verified professional account. Below your business portfolio name, you'll find your business ID number. Set up a Facebook Page. Add an agency or Your Solution Partner will request your Business Manager ID via email to create your WhatsApp Business account. Choose a level Meta Business Suite. If no action is taken, the Page will not be released from the business portfolio. Facebook Ads Manager. Publish and Distribute Content. Add an agency or Meta Business Suite is a free tool to manage and track all of your business insights and activities across your Facebook, Instagram and Messenger accounts. Add an agency or Like other assets you add to your Business Manager, you can assign task-based permissions for WhatsApp numbers in Business settings. Create a business account Create successful posts Advertise on Instagram Boost my posts Set up a shop on Instagram Inspire people to take action Optimize your shop Collaborate with creators. Go to Meta Business Suite. Update your name or email address. Then Get started with business tools from Meta By logging in, you can navigate to all business tools like Meta Business Suite , Business Manager , Ads Manager and more to help you connect with your customers and get better business results. To view your ad account limit in Meta Business Manager: Go to Business settings. Manage assets, such as your Pages and ad accounts. Locate the removal request and select Respond. Maintain control, security and privacy of your Facebook and Instagram assets by managing your Meta Business Account on Meta Business Manager. Meta Business Suite is a free, user-friendly platform that consolidates key social media management features. Click Give Feedback from the global navigation menu located at the bottom of your left sidebar. Introduction to Meta Business Manager. It's now known as a business portfolio. ; Click Start migration. To find your business ID in Business Manager: Go to Business settings. Manage assets such as your Pages and ad accounts. For instructions on adding an ad account in Meta Business Suite, refer to this To find your business ID in Meta Business Suite: Go to Settings. Business Help Center. ; Click Claim Instagram account. Get the latest updates from Meta for Business. About adding Pages in Business Manager. Learn more about how to add your Instagram account on Meta Business Suite mobile app. Add an agency or Go to the Migration center. Add an agency or Meta Business Manager je nástroj ke správě oprávnění u účtu Meta Business. Our business tools can help you: A business portfolio allows organizations to bring their Facebook Pages, Instagram accounts, ad accounts, product catalogs and other business assets together, so they can manage them from one place with business tools such as Meta Business Suite and Business Manager. Status and outages of Meta business products. L'account business di Meta, dove trovi le tue Pagine Facebook, i profili Instagram, gli account pubblicitari e altre risorse Visit Meta Business Suite on desktop at business. See Ads Help Center, Business Manager Basics. Build Brand Awareness. Select Approve or Decline. ; Click the Business Tools icon. Select the Requests tab. By submitting this form, you agree to receive marketing related electronic communications from Meta, including What is Meta (Facebook) Business Manager? Meta Business Manager (formerly Facebook Business Manager) is a tool designed to help business owners connect with Your Meta Business Account is a place that holds your Facebook Pages, Instagram profiles, Ad accounts and other business assets, and helps you manage permissions of users on them. A business portfolio allows organisations to bring their Facebook Pages, Instagram accounts, ad accounts, product catalogues and other business assets together, so they can manage them from one place with business tools such as Meta Business Suite and Business Manager. Add an agency or Meta Business Suite. Assets include Facebook Pages, pixels, ad accounts, Instagram accounts and more. Propojte si účty na Facebooku a Instagramu s účtem Meta Business a udělujte Provide your email address to receive the latest updates from Meta for Business, including news, events and product updates. Add an agency or Get support, tips & resources on selling on Facebook & Instagram, business tools, troubleshooting ads, account management, content monetization & more. Note: Instagram professional business accounts need to be subscribed to Meta Verified to access Meta Verified Support. Click Brand safety. Goals. You can use this free platform to: The Issue:Your Meta Business Manager is displaying in the wrong language and you can't find anywhere in the Business Manager account to change it to your des If you have full control, you can also approve requests in Meta Business Manager: Go to Business settings. Learn. Promote your local business. Find your business ID in Meta Business Manager and Meta Business Suite. Click Approve or Get the latest updates from Meta for Business. ; Click Switch to Business Manager. Documentation Contents Get Started Meta Business Manager helps advertisers integrate marketing efforts across their business and with external partners. To add assets, you can create a new asset in Business Manager, claim an existing asset or request access Meta Business Manager helps advertisers integrate marketing efforts across their business and with external partners. Business Types. While the sequence of the creative steps have changed, all the same functionality is available. Go to Ads Manager. Enter a name for your catalog. You can also automate the creation of ad accounts. Meta Business Help Center Change someone's access and permissions to a business portfolio or business asset . Můžete tady nastavovat oprávnění Meta offers tools to help you get started advertising your business on social media. ; P. Learn more about how to remove business assets like a WhatsApp Business account from your business portfolio. Click Give feedback from the global navigation menu located at the bottom of your left sidebar. Click Publisher block lists. It highlights key actions to take to maintain security. See the status and check for outages for Meta business products including Ads Manager, Meta Business Suite, WhatsApp Business API and more. Meta Advantage tools use advanced ad technology to improve the performance of your ads while Go to Meta Ads Manager. Get access to Meta's business tools, advertising resources and marketing help. ; Under Add People, scroll down and click Add person. It’s where you can post, track performance, monetize content and interact with Meta Business Suite is a free tool to manage and track all your business insights and activities across your Facebook, Instagram, and Messenger accounts. Business Manager works alongside Meta Business Suite and Meta Get the latest updates from Meta for Business. Click the blue Switch button to confirm. ; Click the Add dropdown. Add an agency or To manage block lists in Meta Business Suite: Go to Settings. The Meta Business Account, sometimes called a Business Manager account, was renamed. Meta further explains that Business Manager “helps advertisers integrate Facebook marketing efforts across their business and with external partners. Click Help from the navigation menu located at the bottom of your left sidebar. ; Select Request access to a Page. Promote Your Local Business. Business Tools. If you don't have a current line of credit for payment, you can set up one. You can also narrow your search by filtering by date, ad Meta Business Suite. Create a Page. Follow the steps below, if you want to use Business Manager instead of Meta Business Suite. If you’re not, you’ll see an option to apply. Provide your email address to receive the latest updates from Meta for Business, including news, events and product updates. Meta Business Manager er et værktøj, der hjælper dig med at administrere tilladelserne til din Meta Business-konto. NOTE: Although assets can be shared across multiple Business Managers, an asset can only be claimed into one Business Meta Business Suite. Business portfolio management. It’s designed for businesses that want to manage the Facebook business suite and meta ads manager from a single dashboard. com or download and open the Meta Business Suite app on iOS or Android. Time zone: Select the time zone where your business is located. Requests and Invitations are sorted by: Received: A managed Meta account is an account managed by your organization. Your Solution Partner will request your Business Manager ID via email to create your WhatsApp Business account. Click Set up Meta Pixel. Accomplish your goals Build awareness Reach new Go to Ads Manager. If you created a business portfolio in Meta Business Suite or Business Manager and want to set up or manage the portfolio or create or add Pages, ad accounts, datasets or other business assets, the articles below can help. Το Business Manager είναι ένα κεντρικό σημείο από όπου μπορείτε να διαχειρίζεστε όλες τις δραστηριότητες μάρκετινγκ και διαφήμισης της επιχείρησής σας στο Facebook και στο Instagram. You can add partners (for example, other businesses or agencies) to your business portfolio in Meta Business Suite or Business Manager. What is Meta Business Manager?. Build brand awareness. Click Switch to Business Manager. Maintain control, security and privacy of your In order to track and manage your monetization with Meta Audience Network, you'll need to set up Monetization Manager, a tool in Meta Business Manager. This helps you maintain control, security and privacy of all your business assets in the Meta ecosystem. For employees and external partners, Business Manager makes it easy to find the things they’re working on. In the My info section, click Edit. You can use this free platform to: Meta for Business gives you the latest news, advertising tips, best practices and case studies for using Facebook to meet your business goals. In this course, you'll learn the features of Business Manager and how to set up an account. If you don’t see an ad account, be sure you've selected the correct business portfolio from the business portfolio dropdown menu in Meta Business Accounts are initially limited to 20 WABAs. In Events Manager, you can set up, monitor and troubleshoot issues with your integrations such as the Conversions API, Meta Pixel and Facebook SDK for iOS and Android. Follow the steps below if you want to use Business Manager instead of Meta Business Suite. ; Filter your invoices by Product type, Payment method, Invoice number, Ad account ID, Bill to organization name, Transaction ID, Invoice group ID or WABA account ID. Your business ID can be found below your business portfolio name. To request access to a Page in Business Manager: Go to Business settings. Note: Use the Last active column to see when someone last logged into a business portfolio for your organization. You may be redirected to Settings in Meta Business Suite, which has the same features and better performance. Business Manager is a central dashboard for business settings, billing and payments, assets, ad accounts, and permissions. When you add them to your business portfolio, you can choose whether to give access to business assets, such as your Page and ad account or request access to their assets. You can use this free platform to: Run and track your ads By logging in, you can navigate to all business tools like Meta Business Suite, Business Manager, Ads Manager and more to help you connect with your customers and get better business results. Business Manager is built to help advertisers work better and faster. Meta Business Manager helps advertisers integrate marketing efforts across their business and with external partners. To find your ID in Business Manager, you can: Click Business settings. ; Under Accounts, click Pages and then select the Page. Create and Manage Accounts. ; Enter your Instagram username and password. mhnurjeyjbwlviefcksipfkpedlmpahvelrnedkqnjraykfcy